PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DS_59260A671.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 395aa    MW: 43658.7 Da    PI: 6.628
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DS_59260A671.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.73e-1475118145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            r +W++eE + l + ++++G ++W t+a+ ++ gR++ qc+ rw+
  Traes_6DS_59260A671.2  75 RVKWSEEENKVLTQMINKHGLKNWQTVAHAIP-GRSAPQCRQRWR 118
                            789*****************************.***********8 PP

2Myb_DNA-binding38.82.2e-12127169145
                            TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                            + +W+++E+++l++a++ +G++ W+   ++++ gRt   +k++w+
  Traes_6DS_59260A671.2 127 KEAWSEQEELRLIRAHQIYGTK-WREMVKHFP-GRTNGAIKEYWR 169
                            579*******************.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.66970121IPR017930Myb domain
SMARTSM007172.1E-1274123IPR001005SANT/Myb domain
SuperFamilySSF466899.73E-2475168IPR009057Homeodomain-like
CDDcd001676.47E-1377118No hitNo description
Gene3DG3DSA:1.10.10.603.4E-1977130IPR009057Homeodomain-like
PfamPF139211.0E-1278138No hitNo description
PROSITE profilePS5129418.2122176IPR017930Myb domain
SMARTSM007173.4E-10126174IPR001005SANT/Myb domain
CDDcd001676.37E-10129169No hitNo description
Gene3DG3DSA:1.10.10.604.8E-16131177IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 395 aa     Download sequence    Send to blast
MSRIGDLMPR ERSVNSTSHS RKADGDSANV SGTPHDTAKH CHDEELGNIG GQLCKNDGHS  60
FKESCSITNS EVLTRVKWSE EENKVLTQMI NKHGLKNWQT VAHAIPGRSA PQCRQRWRYK  120
IDSAINKEAW SEQEELRLIR AHQIYGTKWR EMVKHFPGRT NGAIKEYWRG PMKRKLNSYL  180
SSGLLEQFPD ILENLSGTQN NSLDILKGTK VSDILNDTEG SSERNEMSSA VPRISISEVG  240
FTEVGENADV PGGESADFIY ARVASAKAPE NIIARSEQHA KTRRKLDLLS SPVELKSSSH  300
EVNSQRPLQQ REQMSPAVGG VSPSNGCHDV LPKILSECAK PVLSPTGSYQ PSDVHSAGTS  360
DPCSLELDIS DLMEMSYFDN LLIFPPGSPH DGNSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-23731785110B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519050.0JF951905.1 Triticum aestivum clone TaMYB22 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010234128.11e-172PREDICTED: myb-related protein B-like isoform X1
RefseqXP_010234127.11e-172PREDICTED: myb-related protein B-like isoform X1
TrEMBLW5H2S90.0W5H2S9_WHEAT; Uncharacterized protein
STRINGBRADI3G10067.11e-161(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP142631723
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G11510.12e-39myb domain protein 3r-4
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]